Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against S100A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A5 |
| Target Synonyms | S100D; S100A5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK | Uniprot ID | P33763 |
Uniprot Id
P33763
Target Species
Human
Target Name
S100A5
Target Full Name
Protein S100-A5
Target Function
Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
Target Protein Families
S-100 family
Target Synonyms
Protein S-100D; Protein S100-A5; S100 calcium binding protein A5; S100 calcium-binding protein A5; S100a5; S100D; S100D9; S10A5_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
