-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A7/Psoriasin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A7/Psoriasin (NP_002954.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against S100A7/Psoriasin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A7/Psoriasin (NP_002954.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-04453A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A7/Psoriasin |
| Target Synonyms | PSOR1; S100A7c; S100A7/Psoriasin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A7/Psoriasin (NP_002954.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ | Uniprot ID | P31151 |
Uniprot Id
P31151
Target Species
Human
Target Name
S100A7
Target Full Name
Protein S100-A7
Target Subcellular Location
Cytoplasm. Secreted. Note=Secreted by a non-classical secretory pathway.
Target Protein Families
S-100 family
Target Tissue Specificity
Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
Target Synonyms
HID 5; Protein S100 A7; Protein S100-A7; PSOR 1; PSOR1; Psoriasin 1; Psoriasin; Psoriasin1; S100 Calcium binding protein A7; S100 calcium-binding protein A7; S100A7; S100A7c; S10A7_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
Notification