-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCG5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-176 of human SCG5 (NP_001138229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCG5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-176 of human SCG5 (NP_001138229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03097A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCG5 |
| Target Synonyms | 7B2; SgV; P7B2; SGNE1; SCG5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-176 of human SCG5 (NP_001138229.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGE | Uniprot ID | P05408 |
Uniprot Id
P05408
Target Species
Human
Target Name
SCG5
Target Full Name
Neuroendocrine protein 7B2
Target Function
Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Target Subcellular Location
Secreted. Note=Neuroendocrine and endocrine secretory granules.
Target Protein Families
7B2 family
Target Synonyms
SCG5; SGNE1Neuroendocrine protein 7B2; Pituitary polypeptide; Secretogranin V; Secretogranin-5; Secretory granule endocrine protein I) [Cleaved into: N-terminal peptide; C-terminal peptide]
Target Background
This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein.
Notification