-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCGB3A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human SCGB3A2 (NP_473364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SCGB3A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human SCGB3A2 (NP_473364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03455A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Scgb3a2 |
| Target Synonyms | LU103; PNSP1; UGRP1; pnSP-1; SCGB3A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse lung, Raji, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human SCGB3A2 (NP_473364.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV | Uniprot ID | Q96PL1 |
Uniprot Id
Q96PL1
Target Species
Human
Target Name
SCGB3A2
Target Full Name
Secretoglobin family 3A member 2
Target Function
Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Strongly inhibits phospholipase A2 (PLA2G1B) activity. Seems to have anti-inflammatory effects in respiratory epithelium. Also has anti-fibrotic activity in lung. May play a role in fetal lung development and maturation. Promotes branching morphogenesis during early stages of lung development. In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH)
Target Subcellular Location
Secreted.
Target Protein Families
Secretoglobin family, UGRP subfamily
Target Tissue Specificity
Highly expressed in lung and trachea. Detected throughout the airway epithelium in lung, with slightly higher expression in large airways. Found in lung submucosal gland acinus where it localizes to serous-like cells. Probably expressed in club/Clara cell
Target Synonyms
LU103; Pneumo secretory protein 1; PnSP-1; PNSP1; SCGB3A2; Secretoglobin family 3A member 2; SG3A2_HUMAN; UGRP1; Uteroglobin-related protein 1
Target Background
The protein encoded by this gene is a secreted lung surfactant protein and a downstream target of thyroid transcription factor. A single nucleotide polymorphism in the promoter of this gene results in susceptibility to asthma.
Notification