Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCML1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human SCML1 (NP_006737.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCML1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human SCML1 (NP_006737.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06919A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCML1 |
| Target Synonyms | SCML1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human SCML1 (NP_006737.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDH | Uniprot ID | Q9UN30 |
Uniprot Id
Q9UN30
Target Species
Human
Target Name
SCML1
Target Full Name
Sex comb on midleg-like protein 1
Target Function
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation.
Target Subcellular Location
Nucleus.
Target Protein Families
SCM family
Target Tissue Specificity
Ubiquitous. Expressed in fetal and adult tissues.
Target Synonyms
SCML1; Sex comb on midleg-like protein 1
Target Background
Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in negative regulation of transcription, DNA-templated. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
