-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-368 of human SCN7A (NP_002967.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCN7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-368 of human SCN7A (NP_002967.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01254A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN7A |
| Target Synonyms | NaG; SCN6A; Nav2.1; Nav2.2; SCN7A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HT-1080 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-368 of human SCN7A (NP_002967.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYHQILYASGK | Uniprot ID | Q01118 |
Uniprot Id
Q01118
Target Species
Human
Target Name
SCN7A
Target Full Name
Sodium channel protein type 7 subunit alpha
Target Function
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium channel (TC 1.A.1.10) family, SCN7A subfamily
Target Tissue Specificity
Heart and uterus.
Target Synonyms
NaG; SCN6A; Nav2.1; Nav2.2; SCN7A
Target Background
This gene encodes one of the many voltage-gated sodium channel proteins. For proper functioning of neurons and muscles during action potentials, voltage-gated sodium channels direct sodium ion diffusion for membrane depolarization. This sodium channel protein has some atypical characteristics; the similarity between the human and mouse proteins is lower compared to other orthologous sodium channel pairs. Also, the S4 segments, which sense voltage changes, have fewer positive charged residues that in other sodium channels; domain 4 has fewer arginine and lysine residues compared to other sodium channel proteins. Several alternatively spliced transcript variants exist, but the full-length natures of all of them remain unknown.
Notification