Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SEC11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09099A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC11A |
| Target Synonyms | SPC18; SPCS4A; SEC11L1; sid2895; 1810012E07Rik; SEC11A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A-549, HepG2, HT-29, Mouse liver, Mouse lung, Raji, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF | Uniprot ID | P67812 |
Uniprot Id
P67812
Target Species
Human
Target Name
SEC11A
Target Full Name
Signal peptidase complex catalytic subunit SEC11A
Target Function
Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Target Subcellular Location
Microsome membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase S26B family
Target Synonyms
SEC11A; SEC11L1; SPC18; SPCS4A; Signal peptidase complex catalytic subunit SEC11A; Endopeptidase SP18; Microsomal signal peptidase 18 kDa subunit; SPase 18 kDa subunit; SEC11 homolog A; SEC11-like protein 1; SPC18
Target Background
This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
