Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEMA4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 749-833 of human SEMA4C (NP_060259.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEMA4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 749-833 of human SEMA4C (NP_060259.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEMA4C |
| Target Synonyms | SEMAF; SEMAI; SEMACL1; M-SEMA-F; SEMA4C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, BT-474, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 749-833 of human SEMA4C (NP_060259.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV | Uniprot ID | Q9C0C4 |
Uniprot Id
Q9C0C4
Target Species
Human
Target Name
SEMA4C
Target Full Name
Semaphorin-4C
Target Function
Cell surface receptor for PLXNB2 that plays an important role in cell-cell signaling. PLXNB2 binding promotes downstream activation of RHOA and phosphorylation of ERBB2 at 'Tyr-1248'. Required for normal brain development, axon guidance and cell migration. Probable signaling receptor which may play a role in myogenic differentiation through activation of the stress-activated MAPK cascade.
Target Subcellular Location
Cell junction, synapse, postsynaptic density membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type I membrane protein.
Target Protein Families
Semaphorin family
Target Synonyms
KIAA1739; M-SEMA-F; S4c; SEM4C_HUMAN; Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C; SEMA4C; SEMACL1; SEMAF; SEMAI; Semaphorin-4C; UNQ5855/PRO34487
Target Background
Predicted to enable chemorepellent activity and semaphorin receptor binding activity. Involved in muscle cell differentiation and positive regulation of stress-activated MAPK cascade. Located in extracellular space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
