Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEMA4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEMA4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10897A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEMA4D |
| Target Synonyms | A8; GR3; BB18; CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G; SEMA4D | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNCYKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD | Uniprot ID | Q92854 |
Uniprot Id
Q92854
Target Species
Human
Target Name
SEMA4D
Target Full Name
Semaphorin-4D
Target Function
Cell surface receptor for PLXNB1 and PLXNB2 that plays an important role in cell-cell signaling. Regulates GABAergic synapse development. Promotes the development of inhibitory synapses in a PLXNB1-dependent manner. Modulates the complexity and arborization of developing neurites in hippocampal neurons by activating PLXNB1 and interaction with PLXNB1 mediates activation of RHOA. Promotes the migration of cerebellar granule cells. Plays a role in the immune system; induces B-cells to aggregate and improves their viability (in vitro). Induces endothelial cell migration through the activation of PTK2B/PYK2, SRC, and the phosphatidylinositol 3-kinase-AKT pathway.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Semaphorin family
Target Tissue Specificity
Strongly expressed in skeletal muscle, peripheral blood lymphocytes, spleen, and thymus and also expressed at lower levels in testes, brain, kidney, small intestine, prostate, heart, placenta, lung and pancreas, but not in colon and liver.
Target Synonyms
A8; BB 18; BB18; CD 100; CD100; CD100 antigen; Coll 4; COLL4; Collapsin 4; Collapsin4; GR3; Leukocyte activation antigen CD100; M sema G; MSEMA; SEM4D_HUMAN; Sema 4d; Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4D; Sema H; SEMA J; Sema4d; Semacl 2; Semacl2; SemaH; SEMAJ; Semaphorin 4D; Semaphorin C like 2; Semaphorin H; Semaphorin J; Semaphorin-4D; Semaphorin4D; SemaphorinJ; Semcl 2; Semcl2
Target Background
Enables identical protein binding activity; semaphorin receptor binding activity; and transmembrane signaling receptor activity. Involved in several processes, including positive regulation of phosphatidylinositol 3-kinase signaling; regulation of neuron projection development; and regulation of phosphate metabolic process. Is integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
