Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEMA4G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-560 of human SEMA4G (NP_001190173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEMA4G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-560 of human SEMA4G (NP_001190173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05016A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEMA4G |
| Target Synonyms | SEMA4G | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 470-560 of human SEMA4G (NP_001190173.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETQVFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTIANRSQGSRTALIQDIERGNR | Uniprot ID | Q9NTN9 |
Uniprot Id
Q9NTN9
Target Species
Human
Target Name
SEMA4G
Target Full Name
Semaphorin-4G
Target Function
Cell surface receptor for PLXNB2. May play a role in axon guidance.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Semaphorin family
Target Synonyms
SEMA4G; KIAA1619; Semaphorin-4G
Target Background
Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
