-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SENP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-501 of human SENP1 (Q9P0U3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SENP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-501 of human SENP1 (Q9P0U3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13872A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SENP1 |
| Target Synonyms | SuPr-2; SENP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-501 of human SENP1 (Q9P0U3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKL | Uniprot ID | Q9P0U3 |
Uniprot Id
Q9P0U3
Target Species
Human
Target Name
SENP1
Target Full Name
Sentrin-specific protease 1
Target Function
Protease that catalyzes two essential functions in the SUMO pathway. The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins. The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. Deconjugates SUMO1 from HIPK2. Deconjugates SUMO1 from HDAC1 and BHLHE40/DEC1, which decreases its transcriptional repression activity. Deconjugates SUMO1 from CLOCK, which decreases its transcriptional activation activity. Deconjugates SUMO2 from MTA1. Deconjugates SUMO1 from METTL3. Desumoylates CCAR2 which decreases its interaction with SIRT1. Deconjugates SUMO1 from GPS2.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Shuttles between cytoplasm and nucleus.
Target Protein Families
Peptidase C48 family
Target Tissue Specificity
Highly expressed in testis. Expressed at lower levels in thymus, pancreas, spleen, liver, ovary and small intestine.
Target Research Area
Cell Biology
Target Synonyms
SENP 1; SENP1; SENP1_HUMAN; Sentrin specific protease 1; Sentrin-specific protease 1; Sentrin/SUMO specific protease 1; Sentrin/SUMO specific protease; Sentrin/SUMO specific protease SENP 1; Sentrin/SUMO specific protease SENP1; Sentrin/SUMO-specific protease SENP1; SUMO1/sentrin specific peptidase 1; SUMO1/sentrin specific protease 1; SuPr 2; SuPr2
Target Background
This gene encodes a cysteine protease that specifically targets members of the small ubiquitin-like modifier (SUMO) protein family. This protease regulates SUMO pathways by deconjugating sumoylated proteins. This protease also functions to process the precursor SUMO proteins into their mature form. Alternate splicing results in multiple transcript variants.
Notification