Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINB13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SERPINB13 (NP_036529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SERPINB13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SERPINB13 (NP_036529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06069A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINB13 |
| Target Synonyms | HUR7; PI13; headpin; HSHUR7SEQ; SERPINB13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse uterus, Rat uterus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SERPINB13 (NP_036529.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA | Uniprot ID | Q9UIV8 |
Uniprot Id
Q9UIV8
Target Species
Human
Target Name
SERPINB13
Target Full Name
Serpin B13
Target Function
May play a role in the proliferation or differentiation of keratinocytes.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Tissue Specificity
Skin specific.
Target Synonyms
HaCaT UV repressible serpin; HaCaT UV-repressible serpin; Headpin; HSHUR7SEQ; HUR7; Hurpin; MGC126870; Peptidase inhibitor 13; PI-13; PI13; Protease inhibitor 13; Proteinase inhibitor 13; Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 13; Serpin B13; Serpin peptidase inhibitor clade B (ovalbumin) member 13; SERPINB13; SPB13_HUMAN; UV B repressed sequence HUR 7
Target Background
The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
