-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 302-491 of human SERPINF2 (NP_001159392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERPINF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 302-491 of human SERPINF2 (NP_001159392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05871A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINF2 |
| Target Synonyms | AAP; API; PLI; A2AP; alpha2AP; ALPHA-2-PI; SERPINF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 302-491 of human SERPINF2 (NP_001159392.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIFEDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSPK | Uniprot ID | P08697 |
Uniprot Id
P08697
Target Species
Human
Target Name
SERPINF2
Target Full Name
Alpha-2-antiplasmin
Target Function
Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin.
Target Involvement
Alpha-2-plasmin inhibitor deficiency (APLID)
Target Subcellular Location
Secreted.
Target Protein Families
Serpin family
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Synonyms
A2AP; A2AP_HUMAN; AAP; Alpha 2 antiplasmin; Alpha 2 antiplasmin pigment epithelium derived factor; Alpha 2 AP; ALPHA 2 PI; Alpha 2 plasmin inhibitor; Alpha 2 plasmin inhibitor deficiency; Alpha-2-antiplasmin; Alpha-2-AP; Alpha-2-PI; Alpha-2-plasmin inhibitor; Antiplasmin deficiency; API; Plasmin inhibitor deficiency; PLI; Serine (or cysteine) peptidase inhibitor; clade F; member 2; Serine (Or cysteine) peptidase inhibitor; clade F; member 2; isoform CRA_c; Serine (or cysteine) proteinase inhibitor; clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2; Serine (Or cysteine) proteinase inhibitor; clade F; member 2; Serine or cysteine peptidase inhibitor clade F member 2; Serpin F2; Serpin peptidase inhibitor clade F; Serpin peptidase inhibitor; clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2; SERPINF2
Target Background
This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification