Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SETD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-473 of human SETD6 (NP_001153777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SETD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-473 of human SETD6 (NP_001153777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02609A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SETD6 |
| Target Synonyms | SETD6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, MCF7, Mouse uterus, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-473 of human SETD6 (NP_001153777.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS | Uniprot ID | Q8TBK2 |
Uniprot Id
Q8TBK2
Target Species
Human
Target Name
SETD6
Target Full Name
N-lysine methyltransferase SETD6
Target Function
Protein-lysine N-methyltransferase. Monomethylates 'Lys-310' of the RELA subunit of NF-kappa-B complex, leading to down-regulation of NF-kappa-B transcription factor activity. Monomethylates 'Lys-8' of H2AZ (H2AZK8me1). Required for the maintenance of embryonic stem cell self-renewal. Methylates PAK4.
Target Subcellular Location
Nucleus.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SETD6 subfamily
Target Synonyms
SETD6; N-lysine methyltransferase SETD6; EC 2.1.1.-; SET domain-containing protein 6
Target Background
This gene encodes a methyltransferase that adds a methyl group to the histone H2AZ, which is involved in nuclear receptor-dependent transcription. The protein also interacts with several endogenous proteins which are involved in nuclear hormone receptor signaling. A related pseudogene is located on chromosome 2. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
