-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHANK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human SHANK2 (NP_036441.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SHANK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human SHANK2 (NP_036441.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHANK2 |
| Target Synonyms | SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3; SHANK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human SHANK2 (NP_036441.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFALGANKDSLSAFEYPGPKRKLYSAVPGRLFVAVKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSK | Uniprot ID | Q9UPX8 |
Uniprot Id
Q9UPX8
Target Species
Human
Target Name
SHANK2
Target Full Name
SH3 and multiple ankyrin repeat domains protein 2
Target Function
Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.
Target Involvement
Autism 17 (AUTS17)
Target Subcellular Location
Apical cell membrane. Cytoplasm. Cell junction, synapse. Cell junction, synapse, postsynaptic density. Cell projection, growth cone. Cell projection, dendritic spine.
Target Protein Families
SHANK family
Target Tissue Specificity
Isoform 3 is present in epithelial colonic cells (at protein level).
Target Synonyms
SHANK2; CORTBP1; KIAA1022; PROSAP1; SH3 and multiple ankyrin repeat domains protein 2; Shank2; Cortactin-binding protein 1; CortBP1; Proline-rich synapse-associated protein 1
Target Background
This gene encodes a protein that is a member of the Shank family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density of excitatory synapses. Shank proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, and an SH3 domain. This particular family member contains a PDZ domain, a consensus sequence for cortactin SH3 domain-binding peptides and a sterile alpha motif. The alternative splicing demonstrated in Shank genes has been suggested as a mechanism for regulating the molecular structure of Shank and the spectrum of Shank-interacting proteins in the postsynaptic densities of the adult and developing brain. Alterations in the encoded protein may be associated with susceptibility to autism spectrum disorder. Alternative splicing results in multiple transcript variants.
Notification