-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SHIP1 (NP_001017915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SHIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SHIP1 (NP_001017915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHIP1 |
| Target Synonyms | SHIP; SHIP1; SHIP-1; hp51CN; SIP-145; p150Ship | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SHIP1 (NP_001017915.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNA | Uniprot ID | Q92835 |
Uniprot Id
Q92835
Target Species
Human
Target Name
INPP5D
Target Full Name
Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
Target Function
Phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2, thereby negatively regulating the PI3K (phosphoinositide 3-kinase) pathways. Able also to hydrolyzes the 5-phosphate of phosphatidylinositol-4,5-bisphosphate (PtdIns(4,5)P3) and inositol 1,3,4,5-tetrakisphosphate. Acts as a negative regulator of B-cell antigen receptor signaling. Mediates signaling from the FC-gamma-RIIB receptor (FCGR2B), playing a central role in terminating signal transduction from activating immune/hematopoietic cell receptor systems. Acts as a negative regulator of myeloid cell proliferation/survival and chemotaxis, mast cell degranulation, immune cells homeostasis, integrin alpha-IIb/beta-3 signaling in platelets and JNK signaling in B-cells. Regulates proliferation of osteoclast precursors, macrophage programming, phagocytosis and activation and is required for endotoxin tolerance. Involved in the control of cell-cell junctions, CD32a signaling in neutrophils and modulation of EGF-induced phospholipase C activity. Key regulator of neutrophil migration, by governing the formation of the leading edge and polarization required for chemotaxis. Modulates FCGR3/CD16-mediated cytotoxicity in NK cells. Mediates the activin/TGF-beta-induced apoptosis through its Smad-dependent expression.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Membrane raft. Cytoplasm, cytoskeleton. Membrane; Peripheral membrane protein.
Target Protein Families
Inositol 1,4,5-trisphosphate 5-phosphatase family
Target Tissue Specificity
Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74% of immature CD34+ cells, whereas within the more mature population of CD33+ cells
Target Synonyms
Inositol polyphosphate 5 phosphatase of 145kDa; 4; 5-trisphosphate 5-phosphatase 1; hp51CN; Inositol polyphosphate 5 phosphatase 145kDa; Inositol polyphosphate 5 phosphatase; Inositol polyphosphate-5-phosphatase of 145 kDa; INPP5D; MGC104855; MGC142140; MGC142142; p150Ship; Phosphatidylinositol 3,4,5 trisphosphate 5 phosphatase 1; Phosphatidylinositol-3; SH2 containing inositol phosphatase isoform b; SH2 domain containing inositol 5' phosphatase 1; SH2 domain containing inositol phosphatase 1; SH2 domain-containing inositol phosphatase 1; SH2 domain-containing inositol-5''-phosphatase 1; SHIP; SHIP-1; SHIP1; SHIP1_HUMAN; Signaling inositol polyphosphate 5 phosphatase SIP 145; SIP-145; SIP145
Target Background
This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3, 4, 5)-trisphosphate and inositol-1, 3, 4, 5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system. Deficiencies in the encoded protein, SHIP1, have been associated with Inflammatory Bowel Disease types such as Crohn's Disease and Ulcerative Colitis. Alternative splicing of this gene results in multiple transcript variants.
Notification