Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SHOX (NP_000442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SHOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SHOX (NP_000442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07248A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHOX |
| Target Synonyms | SS; GCFX; PHOG; SHOXY; SHOX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293T, BxPC-3, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SHOX (NP_000442.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED | Uniprot ID | O15266 |
Uniprot Id
O15266
Target Species
Human
Target Name
SHOX
Target Full Name
Short stature homeobox protein
Target Function
Controls fundamental aspects of growth and development.
Target Involvement
Leri-Weill dyschondrosteosis (LWD); Langer mesomelic dysplasia (LMD); Short stature, idiopathic, X-linked (ISS)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family, Bicoid subfamily
Target Tissue Specificity
SHOXA is expressed in skeletal muscle, placenta, pancreas, heart and bone marrow fibroblast and SHOXB is highly expressed in bone marrow fibroblast followed by kidney and skeletal muscle. SHOXB is not expressed in brain, kidney, liver and lung. Highly exp
Target Synonyms
GCFX; Growth control factor, X linked; Homo sapiens shox gene, alternatively spliced products, complete cds; PHOG; Pseudoautosomal homeobox containing osteogenic; Pseudoautosomal homeobox containing osteogenic protein; Pseudoautosomal homeobox-containing osteogenic protein; Short stature homeobox; Short stature homeobox containing protein; Short stature homeobox protein; Short stature homeobox-containing protein; SHOX; SHOX_HUMAN; SHOXY; SS; Turner syndrome
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
