Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC13A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human SLC13A2 (NP_003975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC13A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human SLC13A2 (NP_003975.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC13A2 |
| Target Synonyms | NaCT; NADC1; SDCT1; NaDC-1; SLC13A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, MCF7, Mouse liver, Rat kidney, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human SLC13A2 (NP_003975.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TREPGFFLGWGNLAFPNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWNIVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVP | Uniprot ID | Q13183 |
Uniprot Id
Q13183
Target Species
Human
Target Name
SLC13A2
Target Full Name
Solute carrier family 13 member 2
Target Function
Cotransport of sodium ions and dicarboxylates such as succinate and citrate.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
SLC13A/DASS transporter (TC 2.A.47) family, NADC subfamily
Target Synonyms
SLC13A2; NADC1; SDCT1; Solute carrier family 13 member 2; Na(+)/dicarboxylate cotransporter 1; NaDC-1; Renal sodium/dicarboxylate cotransporter
Target Background
The protein encoded by this gene is a sodium-coupled citrate transporter that is regulated by the chaperone activity of cyclophilin b. The encoded protein may play a role in the formation of kidney stones.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
