Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC14A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-580 of human SLC14A2 (NP_009094.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC14A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-580 of human SLC14A2 (NP_009094.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03516A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC14A2 |
| Target Synonyms | UT2; UTA; UTR; HUT2; UT-A2; hUT-A6; SLC14A2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, LO2, Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-580 of human SLC14A2 (NP_009094.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FRLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQF | Uniprot ID | Q15849 |
Uniprot Id
Q15849
Target Species
Human
Target Name
SLC14A2
Target Full Name
Urea transporter 2
Target Function
Specialized low-affinity vasopressin-regulated urea transporter. Mediates rapid transepithelial urea transport across the inner medullary collecting duct and plays a major role in the urinary concentrating mechanism.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Urea transporter family
Target Tissue Specificity
Isoform 1 and isoform 2 are expressed in the inner medulla of the kidney.
Target Synonyms
FLJ16167; hUT-A6; HUT2; kidney; MGC119566; MGC119567; Slc14a2; Solute carrier family 14 (urea transporter), member 2; Solute carrier family 14 member 2; Urea transporter 2; Urea transporter; Urea transporter, kidney; UT-A2; UT2; UT2_HUMAN; UTA; UTR
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
