-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC16A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC16A2 (NP_006508.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC16A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC16A2 (NP_006508.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04091A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC16A2 |
| Target Synonyms | AHDS; MCT7; MCT8; XPCT; MCT 7; MCT 8; MRX22; DXS128; DXS128E; SLC16A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, 293T, HT-29, LO2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC16A2 (NP_006508.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG | Uniprot ID | P36021 |
Uniprot Id
P36021
Target Species
Human
Target Name
SLC16A2
Target Full Name
Monocarboxylate transporter 8
Target Function
Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.
Target Involvement
Monocarboxylate transporter 8 deficiency (MCT8 deficiency)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
Target Tissue Specificity
Highly expressed in liver and heart.
Target Synonyms
AHDS; DXS 128; DXS 128E; DXS128; DXS128 E; DXS128E; MCT 7; MCT 8; MCT7; MCT8; Monocarboxylate transporter 7; Monocarboxylate transporter 8; MOT 8; MOT8_HUMAN; MRX 22; MRX22; SLC16 A2 ; SLC16A 2; SLC16A2; Solute carrier family 16 (monocarboxylic acid transporters), member 2; Solute carrier family 16 member 2; Solute carrier family 16, member 2 (monocarboxylic acid transporter 8) ; Solute carrier family 16, member 2 (thyroid hormone transporter); Solute carrier family 16, member 2; X linked PEST containing transporter; X-linked PEST-containing transporter; XPCT
Target Background
This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome.
Notification