-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC24A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC24A4 (NP_705932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC24A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC24A4 (NP_705932.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02081A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC24A4 |
| Target Synonyms | AI2A5; NCKX4; SHEP6; SLC24A2; SLC24A4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, LO2, SGC-7901, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC24A4 (NP_705932.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVFYILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQY | Uniprot ID | Q8NFF2 |
Uniprot Id
Q8NFF2
Target Species
Human
Target Name
SLC24A4
Target Full Name
Sodium/potassium/calcium exchanger 4
Target Function
Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+). Controls the rapid response termination and proper regulation of adaptation in olfactory sensory neurons (OSNs) which subsequently influences how odor information is encoded and perceived. May play a role in calcium transport during amelogenesis.
Target Involvement
Amelogenesis imperfecta, hypomaturation type, 2A5 (AI2A5)
Target Subcellular Location
Cytoplasm. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC24A subfamily
Target Tissue Specificity
Expressed abundantly in all regions of the brain, aorta, lung and thymus. Expressed at lower levels in the stomach and intestine.
Target Synonyms
Na(+)/K(+)/Ca(2+)-exchange protein 4; NCKX4; NCKX4_HUMAN; SHEP6; SLC24A2; SLC24A4; Sodium/potassium/calcium exchanger 4; Solute carrier family 24 (sodium/potassium/calcium exchanger) member 4; Solute carrier family 24 member 4
Target Background
Enables calcium, potassium:sodium antiporter activity. Involved in calcium ion transmembrane transport; potassium ion transmembrane transport; and sodium ion transmembrane transport. Acts upstream of or within cellular calcium ion homeostasis. Part of plasma membrane. Implicated in amelogenesis imperfecta hypomaturation type 2A5.
Notification