Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC25A22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13539A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A22 |
| Target Synonyms | GC1; DEE3; GC-1; EIEE3; NET44; 22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-431, A-549, HepG2, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK | Uniprot ID | Q9H936 |
Uniprot Id
Q9H936
Target Species
Human
Target Name
SLC25A22
Target Full Name
Mitochondrial glutamate carrier 1
Target Function
Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+).
Target Involvement
Epileptic encephalopathy, early infantile, 3 (EIEE3)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Highly expressed in most tissues.
Target Synonyms
SLC25A22; GC1; Mitochondrial glutamate carrier 1; GC-1; Glutamate/H(+ symporter 1; Solute carrier family 25 member 22
Target Background
This gene encodes a mitochondrial glutamate carrier. Mutations in this gene are associated with early infantile epileptic encephalopathy. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
