Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC26A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC26A4 (NP_000432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC26A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC26A4 (NP_000432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC26A4 |
| Target Synonyms | EVA; PDS; DFNB4; TDH2B; SLC26A4 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC26A4 (NP_000432.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEML | Uniprot ID | O43511 |
Uniprot Id
O43511
Target Species
Human
Target Name
SLC26A4
Target Full Name
Pendrin
Target Function
Sodium-independent transporter of chloride and iodide.
Target Involvement
Pendred syndrome (PDS); Deafness, autosomal recessive, 4 (DFNB4)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Target Tissue Specificity
High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
Target Synonyms
deafness; autosomal recessive 4; DFNB4; EVA; NSRD4; PDS; Pendred syndrome; Pendred syndrome homolog; Pendrin; S26A4_HUMAN; SLC26A4; Sodium independent chloride/iodide transporter; Sodium-independent chloride/iodide transporter; Solute carrier family 26 member 4
Target Background
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
