Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC28A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 612-691 of human SLC28A3 (NP_071410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC28A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 612-691 of human SLC28A3 (NP_071410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06448A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC28A3 |
| Target Synonyms | CNT3; SLC28A3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 612-691 of human SLC28A3 (NP_071410.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF | Uniprot ID | Q9HAS3 |
Uniprot Id
Q9HAS3
Target Species
Human
Target Name
SLC28A3
Target Full Name
Solute carrier family 28 member 3
Target Function
Sodium-dependent, pyrimidine- and purine-selective. Involved in the homeostasis of endogenous nucleosides. Exhibits the transport characteristics of the nucleoside transport system cib or N3 subtype (N3/cib) (with marked transport of both thymidine and inosine). Employs a 2:1 sodium/nucleoside ratio. Also able to transport gemcitabine, 3'-azido-3'-deoxythymidine (AZT), ribavirin and 3-deazauridine.
Target Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Concentrative nucleoside transporter (CNT) (TC 2.A.41) family
Target Tissue Specificity
Expressed in pancreas, bone marrow, trachea, mammary gland, liver, prostate, and regions of intestine, brain, lung, placenta, testis, kidney, and heart.
Target Synonyms
SLC28A3; CNT3Solute carrier family 28 member 3; Concentrative Na(+)-nucleoside cotransporter 3; CNT 3; hCNT3
Target Background
Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vascular tone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleoside drugs. SLC28A3 shows broad specificity for pyrimidine and purine nucleosides (Ritzel et al., 2001 [PubMed 11032837]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
