Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC31A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SLC31A1 (NP_001850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC31A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SLC31A1 (NP_001850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10893A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC31A1 |
| Target Synonyms | CTR1; NSCT; COPT1; SLC31A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, Mouse liver, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SLC31A1 (NP_001850.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG | Uniprot ID | O15431 |
Uniprot Id
O15431
Target Species
Human
Target Name
SLC31A1
Target Full Name
High affinity copper uptake protein 1
Target Function
High-affinity, saturable copper transporter involved in dietary copper uptake.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Target Synonyms
SLC31A1; COPT1; CTR1; High affinity copper uptake protein 1; Copper transporter 1; hCTR1; Solute carrier family 31 member 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
