Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09289A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A2 |
| Target Synonyms | AE2; HKB3; BND3L; NBND3; EPB3L1; SLC4A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HT-29, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP | Uniprot ID | P04920 |
Uniprot Id
P04920
Target Species
Human
Target Name
SLC4A2
Target Full Name
Anion exchange protein 2
Target Function
Plasma membrane anion exchange protein of wide distribution.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Synonyms
AE 2; AE2 anion exchanger; Anion exchange protein 2; Anion exchanger 2; B3A2_HUMAN; BAND 3-LIKE PROTEIN; BND3L; EPB3L1; erythrocyte band 3; Erythrocyte membrane protein band 3 like 1; HKB3; MPB3L; NBND3; Non-erythroid band 3-like protein; Slc4a2; Solute carrier family 4 member 2
Target Background
This gene encodes a member of the anion exchanger family of membrane transport proteins. The encoded protein regulates intracellular pH, biliary bicarbonate secretion, and chloride uptake. Reduced expression of this gene may be associated with primary biliary cirrhosis (PBC) in human patients, while differential expression of this gene may be associated with malignant hepatocellular carcinoma, colon and gastric cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
