-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC4A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05432A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A8 |
| Target Synonyms | NBC3; NDCBE; SLC4A8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat kidney, SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL | Uniprot ID | Q2Y0W8 |
Uniprot Id
Q2Y0W8
Target Species
Human
Target Name
SLC4A8
Target Full Name
Electroneutral sodium bicarbonate exchanger 1
Target Function
Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3(-) from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3(-) into the cells. Also mediates lithium-dependent HCO3(-) cotransport. May be regulated by osmolarity.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Tissue Specificity
Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed i
Target Synonyms
Electroneutral Na(+)-driven Cl-HCO3 exchanger; Electroneutral sodium bicarbonate exchanger 1; k-NBC3; S4A8_HUMAN; Slc4a8; SLC4A8 protein; Solute carrier family 4 member 8
Target Background
The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4, 4'-Di-isothiocyanatostilbene-2, 2'-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
Notification