Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-695 of human SLC5A3 (NP_008864.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC5A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-695 of human SLC5A3 (NP_008864.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07272A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A3 |
| Target Synonyms | BCW2; SMIT; SMIT1; SMIT2; SLC5A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 535-695 of human SLC5A3 (NP_008864.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVK | Uniprot ID | P53794 |
Uniprot Id
P53794
Target Species
Human
Target Name
SLC5A3
Target Full Name
Sodium/myo-inositol cotransporter
Target Function
Prevents intracellular accumulation of high concentrations of myo-inositol (an osmolyte) that result in impairment of cellular function.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Synonyms
Na(+)/myo inositol cotransporter; Na(+)/myo-inositol cotransporter; SC5A3_HUMAN; SLC5A3; SMIT; SMIT2; sodium/myo inositol cotransporter 1; Sodium/myo inositol cotransporter; Sodium/myo-inositol cotransporter; solute carrier family 5 (inositol transporters); member 3; Solute carrier family 5 member 3
Target Background
Enables potassium channel regulator activity and transmembrane transporter binding activity. Predicted to be involved in inositol metabolic process; monosaccharide transmembrane transport; and myo-inositol import across plasma membrane. Predicted to act upstream of or within several processes, including peripheral nervous system development; positive regulation of reactive oxygen species biosynthetic process; and regulation of respiratory gaseous exchange. Located in plasma membrane. Part of perinuclear region of cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
