Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human SLC6A6 (NP_001127839.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human SLC6A6 (NP_001127839.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05457A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A6 |
| Target Synonyms | TAUT; HTRDC; SLC6A6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse brain, Mouse liver, NCI-H460, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human SLC6A6 (NP_001127839.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWD | Uniprot ID | P31641 |
Uniprot Id
P31641
Target Species
Human
Target Name
SLC6A6
Target Full Name
Sodium- and chloride-dependent taurine transporter
Target Function
Sodium-dependent taurine and beta-alanine transporter. Chloride ions are necessary for optimal uptake.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A6 subfamily
Target Tissue Specificity
Expressed abundantly in placenta and skeletal muscle, at intermediate levels in heart, brain, lung, kidney and pancreas and at low levels in liver.
Target Synonyms
MGC10619; MGC131729; OTTHUMP00000208177; OTTHUMP00000208180; SC6A6_HUMAN; SLC6A6; Sodium- and chloride-dependent taurine transporter; Solute carrier family 6 (neurotransmitter transporter, taurine), member 6; Solute carrier family 6 member 6; TAUT
Target Background
This gene encodes a multi-pass membrane protein that is a member of a family of sodium and chloride-ion dependent transporters. The encoded protein transports taurine and beta-alanine. There is a pseudogene for this gene on chromosome 21. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
