Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Smad7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad7 (NP_005895.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Smad7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad7 (NP_005895.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12692A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMAD7 |
| Target Synonyms | CRCS3; MADH7; MADH8; Smad7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad7 (NP_005895.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVL | Uniprot ID | O15105 |
Uniprot Id
O15105
Target Species
Human
Target Name
SMAD7
Target Full Name
Mothers against decapentaplegic homolog 7
Target Function
Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
Target Involvement
Colorectal cancer 3 (CRCS3)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Dwarfin/SMAD family
Target Tissue Specificity
Ubiquitous with higher expression in the lung and vascular endothelium.
Target Synonyms
CRCS3; FLJ16482; hSMAD 7; hSMAD7; MAD (mothers against decapentaplegic Drosophila) homolog 7; MAD; Mad homolog 7; MAD homolog 8; MAD mothers against decapentaplegic homolog 7; MADH 7; MADH 8; MADH6; MADH7; MADH8; Mothers Against Decapentaplegic Drosophila Homolog of 6; Mothers Against Decapentaplegic Drosophila Homolog of 7; Mothers against decapentaplegic homolog 7; Mothers against decapentaplegic homolog 8; Mothers against DPP homolog 7; Mothers against DPP homolog 8; SMA- AND MAD-RELATED PROTEIN 7; SMAD 7; SMAD; SMAD family member 7; SMAD, mothers against DPP homolog 7 (Drosophila); SMAD, mothers against DPP homolog 7; SMAD6; Smad7; SMAD7_HUMAN
Target Background
The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
