-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMARCA5/SNF2H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SMARCA5/SNF2H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16034A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMARCA5/SNF2H |
| Target Synonyms | ISWI; SNF2H; hISWI; hSNF2H; WCRF135; SMARCA5/SNF2H | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 953-1052 of human SMARCA5/SNF2H (O60264). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL | Uniprot ID | O60264 |
Uniprot Id
O60264
Target Species
Human
Target Name
SMARCA5
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Target Function
Helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity. Catalytic subunit of ISWI chromatin-remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair; this may require intact histone H4 tails. Within the ISWI chromatin-remodeling complexes, slides edge- and center-positioned histone octamers away from their original location on the DNA template. Catalytic activity and histone octamer sliding propensity is regulated and determined by components of the ISWI chromatin-remodeling complexes. The BAZ1A/ACF1-, BAZ1B/WSTF-, BAZ2A/TIP5- and BAZ2B-containing ISWI chromatin-remodeling complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template in an ATP-dependent manner. The CECR2- and RSF1-containing ISWI chromatin-remodeling complexes do not have the ability to slide mononucleosomes to the center of a DNA template. Binds to core histones together with RSF1, and is required for the assembly of regular nucleosome arrays by the RSF-5 ISWI chromatin-remodeling complex. Involved in DNA replication and together with BAZ1A/ACF1 is required for replication of pericentric heterochromatin in S-phase. Probably plays a role in repression of RNA polymerase I dependent transcription of the rDNA locus, through the recruitment of the SIN3/HDAC1 corepressor complex to the rDNA promoter. Essential component of the WICH-5 ISWI chromatin-remodeling complex (also called the WICH complex), a chromatin-remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH-5 ISWI chromatin-remodeling complex regulates the transcription of various genes, has a role in RNA polymerase I transcription. Within the B-WICH complex has a role in RNA polymerase III transcription. Mediates the histone H2AX phosphorylation at 'Tyr-142', and is involved in the maintenance of chromatin structures during DNA replication processes. Essential component of NoRC-5 ISWI chromatin-remodeling complex, a complex that mediates silencing of a fraction of rDNA by recruiting histone-modifying enzymes and DNA methyltransferases, leading to heterochromatin formation and transcriptional silencing.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
SNF2/RAD54 helicase family, ISWI subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
4933427E24Rik; D030040M08Rik; D330027N15Rik; EC 3.6.1.-; hISWI; hSNF2H; ISWI; MommeD4; SMARCA5; SMCA5_HUMAN; Snf2h; Sucrose nonfermenting like 5; Sucrose nonfermenting protein 2 homolog; Sucrose nonfermenting, yeast, homolog of; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5; WCRF135
Target Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein.
Notification