-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMARCB1/SNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMARCB1/SNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07894A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMARCB1/SNF5 |
| Target Synonyms | RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; SMARCB1/SNF5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Mouse testis, Rat testis, SH-SY5Y, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT | Uniprot ID | Q12824 |
Uniprot Id
Q12824
Target Species
Human
Target Name
SMARCB1
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Target Function
Core component of the BAF (hSWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to create a stable, altered form of chromatin that constrains fewer negative supercoils than normal. This change in supercoiling would be due to the conversion of up to one-half of the nucleosomes on polynucleosomal arrays into asymmetric structures, termed altosomes, each composed of 2 histones octamers. Stimulates in vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Involved in activation of CSF1 promoter. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1.
Target Involvement
Rhabdoid tumor predisposition syndrome 1 (RTPS1); Schwannomatosis 1 (SWNTS1); Coffin-Siris syndrome 3 (CSS3)
Target Subcellular Location
Nucleus.
Target Protein Families
SNF5 family
Target Research Area
Cancer, Cell Cycle
Target Synonyms
BAF47; BRG1-associated factor 47; hSNF5; INI1; Integrase interactor 1 protein; Malignant rhabdoid tumor suppressor; RDT; RTPS1; Sfh1p; SMARCB1; SNF5 homolog; SNF5_HUMAN; SNF5L1; Snr1; Sucrose nonfermenting yeast homolog like 1; SWI/SNF complex component SNF5; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1; SWI10; Transcription factor TYE4; Transcription regulatory protein SNF5; TYE4
Target Background
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Notification