Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMG5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1016 of human SMG5 (NP_056142.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMG5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1016 of human SMG5 (NP_056142.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07201A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMG5 |
| Target Synonyms | EST1B; SMG-5; LPTSRP1; LPTS-RP1; SMG5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 950-1016 of human SMG5 (NP_056142.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG | Uniprot ID | Q9UPR3 |
Uniprot Id
Q9UPR3
Target Species
Human
Target Name
SMG5
Target Full Name
Nonsense-mediated mRNA decay factor SMG5
Target Function
Plays a role in nonsense-mediated mRNA decay. Does not have RNase activity by itself. Promotes dephosphorylation of UPF1. Together with SMG7 is thought to provide a link to the mRNA degradation machinery involving exonucleolytic pathways, and to serve as an adapter for UPF1 to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation. Necessary for TERT activity.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly cytoplasmic, and nuclear. Shuttles between nucleus and cytoplasm. Detected in cytoplasmic mRNA decay bodies.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
SMG5; EST1B; KIAA1089; Protein SMG5; EST1-like protein B; LPTS-RP1; LPTS-interacting protein; SMG-5 homolog; hSMG-5
Target Background
SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
