Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMPX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-88 of human SMPX (NP_055147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMPX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-88 of human SMPX (NP_055147.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02863A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMPX |
| Target Synonyms | Csl; DFN6; MPD7; DFNX4; Chisel; SMPX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-88 of human SMPX (NP_055147.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ | Uniprot ID | Q9UHP9 |
Uniprot Id
Q9UHP9
Target Species
Human
Target Name
SMPX
Target Full Name
Small muscular protein
Target Function
Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
Target Involvement
Deafness, X-linked, 4 (DFNX4)
Target Protein Families
SMPX family
Target Tissue Specificity
Preferentially and abundantly expressed in heart and skeletal muscle.
Target Research Area
others
Target Synonyms
1010001C09Rik; Csl; DFNX4; RP23-60A1.5; Small muscular protein; SMPX; SMPX_HUMAN; Stretch-responsive skeletal muscle protein
Target Background
This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
