-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SNIP1 (NP_078976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SNIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SNIP1 (NP_078976.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNIP1 |
| Target Synonyms | PML1; PMRED; NEDHCS; SNIP1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SNIP1 (NP_078976.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS | Uniprot ID | Q8TAD8 |
Uniprot Id
Q8TAD8
Target Species
Human
Target Name
SNIP1
Target Full Name
Smad nuclear-interacting protein 1
Target Function
Required for pre-mRNA splicing as component of the spliceosome. Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA.
Target Involvement
Psychomotor retardation, epilepsy, and craniofacial dysmorphism (PMRED)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous, with highest expression in heart and skeletal muscle.
Target Synonyms
FHA domain containing protein SNIP1; FHA domain-containing protein SNIP1; FLJ12553; PMRED; Smad nuclear interacting protein (Smad nuclear interacting); smad nuclear interacting protein 1; Smad nuclear interacting protein; Smad nuclear-interacting protein 1; SNIP1 (Smad nuclear interacting protein); SNIP1; SNIP1_HUMAN; Splicing factor arginine/serine rich 4 (Pre mRNA splicing factor SRP75)
Target Background
This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-beta) and nuclear factor kappa-B (NF-kB) signaling. The encoded protein also regulates the stability of cyclin D1 mRNA, and may play a role in cell proliferation and cancer progression. Mutations in this gene are a cause of psychomotor retardation, epilepsy, and craniofacial dysmorphism (PMRED).
Notification