Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNX18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 445-624 of human SNX18 (NP_001096045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNX18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 445-624 of human SNX18 (NP_001096045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09043A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNX18 |
| Target Synonyms | SNAG1; SH3PX2; SH3PXD3B; SNX18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, LO2, Mouse pancreas, Rat kidney, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 445-624 of human SNX18 (NP_001096045.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYDSV | Uniprot ID | Q96RF0 |
Uniprot Id
Q96RF0
Target Species
Human
Target Name
SNX18
Target Full Name
Sorting nexin-18
Target Function
Involved in endocytosis and intracellular vesicle trafficking, both during interphase and at the end of mitosis. Required for efficient progress through mitosis and cytokinesis. Required for normal formation of the cleavage furrow at the end of mitosis. Plays a role in endocytosis via clathrin-coated pits, but also clathrin-independent, actin-dependent fluid-phase endocytosis. Plays a role in macropinocytosis. Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate and promotes membrane tubulation. Stimulates the GTPase activity of DNM2. Promotes DNM2 location at the plasma membrane. Together with DNM2, involved in autophagosome assembly by regulating trafficking from recycling endosomes of phospholipid scramblase ATG9A.
Target Subcellular Location
Endomembrane system; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Recycling endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Sorting nexin family
Target Synonyms
FLJ11997; FLJ32560; FLJ61062; MGC150827; MGC150829; SH3 and PX domain containing protein 3B; SH3 and PX domain-containing protein 3B; SH3PX2; SH3PXD3B; SNAG 1; SNAG1; SNX18; SNX18_HUMAN; Sorting nexin 18; Sorting nexin associated golgi protein 1; Sorting nexin-18; Sorting nexin-associated Golgi protein 1
Target Background
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
