-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOCS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS2 (NP_001257400.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SOCS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS2 (NP_001257400.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16138A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOCS2 |
| Target Synonyms | CIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2; SOCS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS2 (NP_001257400.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV | Uniprot ID | O14508 |
Uniprot Id
O14508
Target Species
Human
Target Name
SOCS2
Target Full Name
Suppressor of cytokine signaling 2
Target Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Target Tissue Specificity
High expression in heart, placenta, lung, kidney and prostate. Predominantly expressed in pulmonary epithelia cells, specifically type II pneumocytes.
Target Research Area
Immunology
Target Synonyms
CIS 2; CIS-2; CIS2; Cish 2; Cish2; Cytokine inducible SH2 protein 2; Cytokine-inducible SH2 protein 2; SOCS 2; SOCS-2; Socs2; SOCS2_HUMAN; SSI 2; SSI-2; SSI2; STAT induced STAT inhibitor 2; STAT-induced STAT inhibitor 2; STATI 2; STATI2; Suppressor of cytokine signaling 2
Target Background
This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway (the JAK/STAT pathway). SOCS family proteins interact with major molecules of signaling complexes to block further signal transduction, in part, by proteasomal depletion of receptors or signal-transducing proteins via ubiquitination. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10, interferon (IFN)-gamma and by cytokine receptors such as growth horomone receptor. The protein encoded by this gene interacts with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R) and is thought to be involved in the regulation of IGF1R mediated cell signaling. This gene has pseudogenes on chromosomes 20 and 22. Alternative splicing results in multiple transcript variants.
Notification