Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPC25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPC25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06756A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPC25 |
| Target Synonyms | AD024; SPBC25; hSpc25; SPC25 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN | Uniprot ID | Q9HBM1 |
Uniprot Id
Q9HBM1
Target Species
Human
Target Name
SPC25
Target Full Name
Kinetochore protein Spc25
Target Function
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore.
Target Protein Families
SPC25 family
Target Synonyms
AD024; hSpc25; Kinetochore protein Spc25; SPBC25; SPC25; SPC25_HUMAN; spindle pole body component 25 homolog
Target Background
This gene encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
