-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SREBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-310 of human SREBF1 (NP_004167.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SREBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-310 of human SREBF1 (NP_004167.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13052A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SREBF1 |
| Target Synonyms | HMD; IFAP2; SREBP1; bHLHd1; SREBF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-310 of human SREBF1 (NP_004167.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAA | Uniprot ID | P36956 |
Uniprot Id
P36956
Target Species
Human
Target Name
SREBF1
Target Full Name
Sterol regulatory element-binding protein 1
Target Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis.; Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation.; Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C. Able to stimulate both lipogenic and cholesterogenic gene expression. Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver. Required for innate immune response in macrophages by regulating lipid metabolism.; Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A. Primarily controls expression of lipogenic gene. Strongly activates global lipid synthesis in rapidly growing cells.; The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.; The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.
Target Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.; [Isoform SREBP-1aDelta]: Nucleus.; [Isoform SREBP-1cDelta]: Nucleus.
Target Protein Families
SREBP family
Target Tissue Specificity
Expressed in a wide variety of tissues, most abundant in liver and adrenal gland. In fetal tissues lung and liver shows highest expression.; [Isoform SREBP-1A]: Predominates in hepatoma cell lines. Also expressed in kidney, brain, white fat, and muscle.;
Target Synonyms
SREBF1; BHLHD1; SREBP1; Sterol regulatory element-binding protein 1; SREBP-1; Class D basic helix-loop-helix protein 1; bHLHd1; Sterol regulatory element-binding transcription factor 1
Target Background
This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes involved in sterol biosynthesis. The encoded protein is synthesized as a precursor that is initially attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription. This cleaveage is inhibited by sterols. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative promoter usage and splicing result in multiple transcript variants, including SREBP-1a and SREBP-1c, which correspond to RefSeq transcript variants 2 and 3, respectively.
Notification