Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SRP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04006A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRP9 |
| Target Synonyms | ALURBP; SRP9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE | Uniprot ID | P49458 |
Uniprot Id
P49458
Target Species
Human
Target Name
SRP9
Target Full Name
Signal recognition particle 9 kDa protein
Target Function
Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
Target Subcellular Location
Cytoplasm.
Target Protein Families
SRP9 family
Target Synonyms
Alu RNA binding protein, 9-KD subunit; ALURBP; Signal recognition particle 9 kDa; Signal recognition particle 9 kDa protein; signal recognition particle 9kD; SRP09_HUMAN; SRP9
Target Background
Predicted to enable RNA binding activity and signal recognition particle binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane. Predicted to be located in cytosol. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
