Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSPN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSPN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02230A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSPN |
| Target Synonyms | KRAG; NSPN; SPN1; SPN2; DAGA5; SSPN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, NIH/3T3, Rat brain, Rat heart, Mouse brain, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ | Uniprot ID | Q14714 |
Uniprot Id
Q14714
Target Species
Human
Target Name
SSPN
Target Full Name
Sarcospan
Target Function
Component of the dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Preferentially associates with the sarcoglycan subcomplex of the DGC.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Tissue Specificity
Isoform 1 is expressed exclusively in heart and skeletal muscle. Isoform 2 is expressed in heart, skeletal muscle, thymus, prostate, testis, ovary, small intestine, colon and spleen.
Target Synonyms
SSPN; KRAG; Sarcospan; K-ras oncogene-associated protein; Kirsten-ras-associated protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
