Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01814A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSR4 |
| Target Synonyms | CDG1Y; TRAPD; SSR4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, LO2, MCF7, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNG | Uniprot ID | P51571 |
Uniprot Id
P51571
Target Species
Human
Target Name
SSR4
Target Full Name
Translocon-associated protein subunit delta
Target Function
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.
Target Involvement
Congenital disorder of glycosylation 1Y (CDG1Y)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
TRAP-delta family
Target Synonyms
SSR4; TRAPD; Translocon-associated protein subunit delta; TRAP-delta; Signal sequence receptor subunit delta; SSR-delta
Target Background
This gene encodes the delta subunit of the translocon-associated protein complex which is involved in translocating proteins across the endoplasmic reticulum membrane. The encoded protein is located in the Xq28 region and is arranged in a compact head-to-head manner with the isocitrate dehydrogenase 3 (NAD+) gamma gene and both genes are driven by a CpG-embedded bidirectional promoter. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
