-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST3GAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human ST3GAL2 (NP_008858.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST3GAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human ST3GAL2 (NP_008858.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06078A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST3GAL2 |
| Target Synonyms | SIAT4B; ST3GALII; Gal-NAc6S; ST3GalA.2; ST3GAL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human ST3GAL2 (NP_008858.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA | Uniprot ID | Q16842 |
Uniprot Id
Q16842
Target Species
Human
Target Name
ST3GAL2
Target Full Name
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
Target Function
A beta-galactoside alpha2-3 sialyltransferase primarily involved in terminal sialylation of ganglio and globo series glycolipids. Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc-terminated glycoconjugates through an alpha2-3 linkage. Sialylates GM1/GM1a, GA1/asialo-GM1 and GD1b gangliosides to form GD1a, GM1b and GT1b, respectively. Together with ST3GAL3, primarily responsible for biosynthesis of brain GD1a and GT1b that function as ligands for myelin-associated glycoprotein MAG on axons, regulating MAG expression and axonal myelin stability and regeneration. Via GT1b regulates TLR2 signaling in spinal cord microglia in response to nerve injury. Responsible for the sialylation of the pluripotent stem cell- and cancer stem cell-associated antigen SSEA3, forming SSEA4. Sialylates with low efficiency asialofetuin, presumably onto O-glycosidically linked Galbeta-(1->3)-GalNAc-O-Ser.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Highly expressed in skeletal muscle and heart and to a much lesser extent in brain, placenta, liver and pancreas. Scarcely detectable in lung and kidney.
Target Synonyms
3-GalNAc-alpha-2; 3-sialyltransferase 2; 3-sialyltransferase; 3-ST 2; Alpha 2; Alpha 2,3-ST; Beta-galactoside alpha-2; Beta-galactoside alpha-2,3-sialyltransferase; CMP N-acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; Gal NAc6S; Gal-beta-1; Gal-NAc6S; SIA4B_HUMAN; sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase); Sialyltransferase 4B; SIAT4-B; SIAT4B; ST3 beta-galactoside alpha-2,3-sialyltransferase 2; ST3Gal II; ST3GAL2; ST3GalA.2; ST3GalII
Target Background
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.
Notification