Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST8SIA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-168 of human ST8SIA4 (NP_778222.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST8SIA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-168 of human ST8SIA4 (NP_778222.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11078A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST8SIA4 |
| Target Synonyms | PST; PST1; SIAT8D; ST8SIA-IV; ST8SIA4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HL-60, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-168 of human ST8SIA4 (NP_778222.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR | Uniprot ID | Q92187 |
Uniprot Id
Q92187
Target Species
Human
Target Name
ST8SIA4
Target Full Name
CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
Target Function
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
Target Research Area
Tags & Cell Markers
Target Synonyms
ST8SIA4; PST; PST1; SIAT8D; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase; EC 2.4.99.-; Alpha-2,8-sialyltransferase 8D; Polysialyltransferase-1; Sialyltransferase 8D; SIAT8-D; Sialyltransferase St8Sia IV; ST8SiaIV
Target Background
The protein encoded by this gene catalyzes the polycondensation of alpha-2, 8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
