-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human STAM2 (NP_005834.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human STAM2 (NP_005834.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02711A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAM2 |
| Target Synonyms | Hbp; STAM2A; STAM2B; STAM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, OVCAR3, PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human STAM2 (NP_005834.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL | Uniprot ID | O75886 |
Uniprot Id
O75886
Target Species
Human
Target Name
STAM2
Target Full Name
Signal transducing adapter molecule 2
Target Function
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
Target Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
STAM family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp564C047; Hbp; Hrs-binding protein; HSE1 homolog; Signal transducing adapter molecule 2; Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; Signal transducing adaptor molecule 2A; Signal transducing adaptor molecule 2B; Signal transducing adaptor molecule; STAM like protein containing SH3 and ITAM domains 2; STAM-2; Stam2; STAM2_HUMAN; STAM2A; STAM2B
Target Background
The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM, this protein acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. This protein and STAM thus are thought to exhibit compensatory effects on the signaling pathway downstream of JAK kinases upon cytokine stimulation.
Notification