Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STEAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STEAP1 (NP_036581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STEAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STEAP1 (NP_036581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07020A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STEAP1 |
| Target Synonyms | STEAP; PRSS24; STEAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, DU145, HepG2, Mouse testis, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STEAP1 (NP_036581.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI | Uniprot ID | Q9UHE8 |
Uniprot Id
Q9UHE8
Target Species
Human
Target Name
STEAP1
Target Full Name
STEAP1 protein
Target Function
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Target Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Target Protein Families
STEAP family
Target Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.
Target Research Area
Epigenetics and Nuclear Signaling, Transport
Target Synonyms
STEAP1; PRSS24; STEAP; Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1
Target Background
This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
