-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STEAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STEAP3 (NP_060704.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STEAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STEAP3 (NP_060704.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06509A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STEAP3 |
| Target Synonyms | STMP3; TSAP6; pHyde; AHMIO2; dudlin-2; dudulin-2; STEAP3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STEAP3 (NP_060704.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE | Uniprot ID | Q658P3 |
Uniprot Id
Q658P3
Target Species
Human
Target Name
STEAP3
Target Full Name
Metalloreductase STEAP3
Target Function
Endosomal ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells. Participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). Can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. Uses NADP(+) as acceptor. May play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. Indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCTP.
Target Involvement
Anemia, hypochromic microcytic, with iron overload 2 (AHMIO2)
Target Subcellular Location
Endosome membrane; Multi-pass membrane protein. Note=Localizes to vesicular-like structures at the plasma membrane and around the nucleus.
Target Protein Families
STEAP family
Target Tissue Specificity
Expressed in adult bone marrow, placenta, liver, skeletal muscle and pancreas. Down-regulated in hepatocellular carcinoma.
Target Synonyms
STEAP3; TSAP6; Metalloreductase STEAP3; Dudulin-2; Six-transmembrane epithelial antigen of prostate 3; Tumor suppressor-activated pathway protein 6; hTSAP6; pHyde; hpHyde
Target Background
This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants.
Notification