-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STEAP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STEAP4 (NP_001192245) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STEAP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STEAP4 (NP_001192245) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07082A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STEAP4 |
| Target Synonyms | TIARP; STAMP2; SchLAH; TNFAIP9; STEAP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STEAP4 (NP_001192245). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKI | Uniprot ID | Q687X5 |
Uniprot Id
Q687X5
Target Species
Human
Target Name
STEAP4
Target Full Name
Metalloreductase STEAP4
Target Function
Integral membrane protein that functions as NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane. Mediates sequential transmembrane electron transfer from NADPH to FAD and onto heme, and finally to the Fe(3+) chelate. Can also reduce Cu(2+) to Cu(1+). Plays a role in systemic metabolic homeostasis, integrating inflammatory and metabolic responses. Associated with obesity and insulin-resistance. Involved in inflammatory arthritis, through the regulation of inflammatory cytokines. Inhibits anchorage-independent cell proliferation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
Target Protein Families
STEAP family
Target Tissue Specificity
Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheumatoid arthritis and
Target Synonyms
STEAP4; STAMP2; TNFAIP9; Metalloreductase STEAP4; Six-transmembrane epithelial antigen of prostate 4; SixTransMembrane protein of prostate 2; Tumor necrosis factor, alpha-induced protein 9
Target Background
The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+), using NAD(+) as acceptor. Studies in mice and human suggest that this gene maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification