-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STIP1 (P31948) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against STIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STIP1 (P31948) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16649A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STIP1 |
| Target Synonyms | HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521; STIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, A-549, Mouse brain, Mouse testis, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STIP1 (P31948). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG | Uniprot ID | P31948 |
Uniprot Id
P31948
Target Species
Human
Target Name
STIP1
Target Full Name
Stress-induced-phosphoprotein 1
Target Function
Acts as a co-chaperone for HSP90AA1. Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90.
Target Subcellular Location
Cytoplasm. Nucleus. Dynein axonemal particle.
Target Research Area
Signal Transduction
Target Synonyms
Epididymis secretory sperm binding protein Li 94n; HEL S 94n; Hop; Hsc70/Hsp90 organizing protein; Hsc70/Hsp90-organizing protein; IEF SSP 3521; NY REN 11 antigen; P60; Renal carcinoma antigen NY-REN-11; STI1; STI1L; STIP1; STIP1_HUMAN; Stress induced phosphoprotein 1; Stress-induced-phosphoprotein 1; Transformation sensitive protein IEF SSP 3521; Transformation-sensitive protein IEF SSP 3521
Target Background
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).
Notification