Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STK31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 890-1019 of human STK31 (NP_113602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STK31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 890-1019 of human STK31 (NP_113602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03435A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STK31 |
| Target Synonyms | TDRD8; SGK396; STK31 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 890-1019 of human STK31 (NP_113602.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDLSLMSPELKMGKPASPGSDLYAYGCLLLWLSVQNQEFEINKDGIPKVDQFHLDDKVKSLLCSLICYRSSMTAEQVLNAECFLMPKEQSVPNPEKDTEYTLYKKEEEIKTENLDKCMEKTRNGEANFDC | Uniprot ID | Q9BXU1 |
Uniprot Id
Q9BXU1
Target Species
Human
Target Name
STK31
Target Full Name
Serine/threonine-protein kinase 31
Target Synonyms
Serine/threonine kinase 31; Serine/threonine protein kinase 31; Serine/threonine protein kinase NYD SPK; Serine/threonine-protein kinase 31; Serine/threonine-protein kinase NYD-SPK; SgK396; STK 31; Stk31; STK31_HUMAN; Sugen kinase 396; TDRD8; Testis tissue sperm-binding protein Li 78m; Tudor domain containing 8
Target Background
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
